SCOP 1.75: Domain d351ca_: 351c A:

Lineage for d351ca_ (351c A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c551 [46660] (4 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [46662] (4 PDB entries)

8. Domain d351ca_: 351c A: [15905]
   complexed with hem

Details for d351ca_

PDB Entry: 351c, 1.6 Å

PDB Description: structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms

PDB Compounds: (A:) cytochrome c551

SCOP Domain Sequences for d351ca_:

Sequence; same for both SEQRES and ATOM records:

>d351ca_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 287]}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

Timeline for d351ca_:

• d351ca_ first appeared (with stable ids) in SCOP 1.55, called d351c__
  
• d351ca_ appears in SCOP 1.73
  
• d351ca_ appears in SCOPe 2.01
  
• d351ca_ appears in the current release, SCOPe 2.08