Lineage for d351ca_ (351c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690878Protein Cytochrome c551 [46660] (5 species)
  7. 2690899Species Pseudomonas aeruginosa [TaxId:287] [46662] (4 PDB entries)
  8. 2690901Domain d351ca_: 351c A: [15905]
    complexed with hem

Details for d351ca_

PDB Entry: 351c (more details), 1.6 Å

PDB Description: structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms
PDB Compounds: (A:) cytochrome c551

SCOPe Domain Sequences for d351ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d351ca_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 287]}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

SCOPe Domain Coordinates for d351ca_:

Click to download the PDB-style file with coordinates for d351ca_.
(The format of our PDB-style files is described here.)

Timeline for d351ca_: