Lineage for d451ca_ (451c A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1476890Protein Cytochrome c551 [46660] (4 species)
  7. 1476911Species Pseudomonas aeruginosa [TaxId:287] [46662] (4 PDB entries)
  8. 1476912Domain d451ca_: 451c A: [15904]
    complexed with hem

Details for d451ca_

PDB Entry: 451c (more details), 1.6 Å

PDB Description: structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms
PDB Compounds: (A:) cytochrome c551

SCOPe Domain Sequences for d451ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d451ca_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 287]}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

SCOPe Domain Coordinates for d451ca_:

Click to download the PDB-style file with coordinates for d451ca_.
(The format of our PDB-style files is described here.)

Timeline for d451ca_: