Lineage for d1cch__ (1cch -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1015Protein Cytochrome c551 [46660] (4 species)
  7. 1025Species Pseudomonas stutzeri [TaxId:316] [46661] (2 PDB entries)
  8. 1026Domain d1cch__: 1cch - [15902]

Details for d1cch__

PDB Entry: 1cch (more details)

PDB Description: the solution conformation of cytochrome c-551 from p.stutzeri zobell determined by nmr+

SCOP Domain Sequences for d1cch__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cch__ a.3.1.1 (-) Cytochrome c551 {Pseudomonas stutzeri}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
mppnpvteeeakilaewvlslk

SCOP Domain Coordinates for d1cch__:

Click to download the PDB-style file with coordinates for d1cch__.
(The format of our PDB-style files is described here.)

Timeline for d1cch__: