Lineage for d1hroa_ (1hro A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760663Protein Cytochrome c2 [46650] (8 species)
  7. 760681Species Rhodopila globiformis [TaxId:1071] [46656] (1 PDB entry)
  8. 760682Domain d1hroa_: 1hro A: [15897]

Details for d1hroa_

PDB Entry: 1hro (more details), 2.2 Å

PDB Description: molecular structure of a high potential cytochrome c2 isolated from rhodopila globiformis
PDB Compounds: (A:) cytochrome c2

SCOP Domain Sequences for d1hroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hroa_ a.3.1.1 (A:) Cytochrome c2 {Rhodopila globiformis [TaxId: 1071]}
sappgdpvegkhlfhticitchtdikgankvgpslygvvgrhsgiepgynyseaniksgi
vwtpdvlfkyiehpqkivpgtkmgypgqpdpqkradiiayletlk

SCOP Domain Coordinates for d1hroa_:

Click to download the PDB-style file with coordinates for d1hroa_.
(The format of our PDB-style files is described here.)

Timeline for d1hroa_: