SCOPe 2.01: Domain d1hh7a_: 1hh7 A:

Lineage for d1hh7a_ (1hh7 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)

8. Domain d1hh7a_: 1hh7 A: [15896]
   complexed with hec, nh3, so4

Details for d1hh7a_

PDB Entry: 1hh7, 1.4 Å

PDB Description: refined crystal structure of cytochrome c2 from rhodopseudomonas palustris at 1.4 angstrom resolution

PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1hh7a_:

Sequence; same for both SEQRES and ATOM records:

>d1hh7a_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas palustris [TaxId: 1076]}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

Timeline for d1hh7a_:

• d1hh7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1hh7a_ appears in SCOP 1.75
  
• d1hh7a_ appears in SCOPe 2.02
  
• d1hh7a_ appears in the current release, SCOPe 2.08