Lineage for d1co6a_ (1co6 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209882Protein Cytochrome c2 [46650] (8 species)
  7. 209912Species Rhodopseudomonas viridis [TaxId:1079] [46654] (3 PDB entries)
  8. 209913Domain d1co6a_: 1co6 A: [15894]
    complexed with hem

Details for d1co6a_

PDB Entry: 1co6 (more details), 1.6 Å

PDB Description: crystal structure of ferrocytochrome c2 from rhodopseudomonas viridis

SCOP Domain Sequences for d1co6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1co6a_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas viridis}
qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk

SCOP Domain Coordinates for d1co6a_:

Click to download the PDB-style file with coordinates for d1co6a_.
(The format of our PDB-style files is described here.)

Timeline for d1co6a_: