SCOP 1.75: Domain d1cxaa_: 1cxa A:

Lineage for d1cxaa_ (1cxa A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)

8. Domain d1cxaa_: 1cxa A: [15893]
   complexed with hem, imd

Details for d1cxaa_

PDB Entry: 1cxa, 2.2 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

PDB Compounds: (A:) cytochrome c2

SCOP Domain Sequences for d1cxaa_:

Sequence; same for both SEQRES and ATOM records:

>d1cxaa_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

Timeline for d1cxaa_:

• d1cxaa_ first appeared (with stable ids) in SCOP 1.55, called d1cxa__
  
• d1cxaa_ appears in SCOP 1.73
  
• d1cxaa_ appears in SCOPe 2.01
  
• d1cxaa_ appears in the current release, SCOPe 2.08