Lineage for d1cxa__ (1cxa -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149466Protein Cytochrome c2 [46650] (8 species)
  7. 149474Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 149478Domain d1cxa__: 1cxa - [15893]

Details for d1cxa__

PDB Entry: 1cxa (more details), 2.2 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

SCOP Domain Sequences for d1cxa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxa__ a.3.1.1 (-) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOP Domain Coordinates for d1cxa__:

Click to download the PDB-style file with coordinates for d1cxa__.
(The format of our PDB-style files is described here.)

Timeline for d1cxa__: