SCOPe 2.01: Domain d2cxbb_: 2cxb B:

Lineage for d2cxbb_ (2cxb B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)

8. Domain d2cxbb_: 2cxb B: [15892]
   complexed with hem

Details for d2cxbb_

PDB Entry: 2cxb, 1.95 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

PDB Compounds: (B:) cytochrome c2

SCOPe Domain Sequences for d2cxbb_:

Sequence; same for both SEQRES and ATOM records:

>d2cxbb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
egdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygegm
keagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqva
vrp

Timeline for d2cxbb_:

• d2cxbb_ first appeared (with stable ids) in SCOP 1.55
  
• d2cxbb_ appears in SCOP 1.75
  
• d2cxbb_ appears in SCOPe 2.02
  
• d2cxbb_ appears in the current release, SCOPe 2.08