Lineage for d2cxbb_ (2cxb B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209882Protein Cytochrome c2 [46650] (8 species)
  7. 209890Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 209893Domain d2cxbb_: 2cxb B: [15892]
    complexed with hem

Details for d2cxbb_

PDB Entry: 2cxb (more details), 1.95 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

SCOP Domain Sequences for d2cxbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxbb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter sphaeroides}
egdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygegm
keagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqva
vrp

SCOP Domain Coordinates for d2cxbb_:

Click to download the PDB-style file with coordinates for d2cxbb_.
(The format of our PDB-style files is described here.)

Timeline for d2cxbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cxba_