Lineage for d2cxbb_ (2cxb B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149466Protein Cytochrome c2 [46650] (8 species)
  7. 149474Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 149477Domain d2cxbb_: 2cxb B: [15892]

Details for d2cxbb_

PDB Entry: 2cxb (more details), 1.95 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

SCOP Domain Sequences for d2cxbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxbb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter sphaeroides}
egdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygegm
keagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqva
vrp

SCOP Domain Coordinates for d2cxbb_:

Click to download the PDB-style file with coordinates for d2cxbb_.
(The format of our PDB-style files is described here.)

Timeline for d2cxbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cxba_