Lineage for d2cxba_ (2cxb A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209882Protein Cytochrome c2 [46650] (8 species)
  7. 209890Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 209892Domain d2cxba_: 2cxb A: [15891]

Details for d2cxba_

PDB Entry: 2cxb (more details), 1.95 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

SCOP Domain Sequences for d2cxba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxba_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter sphaeroides}
egdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygegm
keagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqva
vrp

SCOP Domain Coordinates for d2cxba_:

Click to download the PDB-style file with coordinates for d2cxba_.
(The format of our PDB-style files is described here.)

Timeline for d2cxba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cxbb_