SCOP 1.75: Domain d1cxca_: 1cxc A:

Lineage for d1cxca_ (1cxc A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)

8. Domain d1cxca_: 1cxc A: [15890]
   complexed with hem

Details for d1cxca_

PDB Entry: 1cxc, 1.6 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

PDB Compounds: (A:) cytochrome c2

SCOP Domain Sequences for d1cxca_:

Sequence; same for both SEQRES and ATOM records:

>d1cxca_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

Timeline for d1cxca_:

• d1cxca_ first appeared (with stable ids) in SCOP 1.55, called d1cxc__
  
• d1cxca_ appears in SCOP 1.73
  
• d1cxca_ appears in SCOPe 2.01
  
• d1cxca_ appears in the current release, SCOPe 2.08