Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries) |
Domain d1cxca_: 1cxc A: [15890] complexed with hem |
PDB Entry: 1cxc (more details), 1.6 Å
SCOP Domain Sequences for d1cxca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxca_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]} qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv avrp
Timeline for d1cxca_: