Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Rhodospirillum rubrum [TaxId:1085] [46651] (2 PDB entries) |
Domain d3c2ca_: 3c2c A: [15885] complexed with hem |
PDB Entry: 3c2c (more details), 1.68 Å
SCOPe Domain Sequences for d3c2ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c2ca_ a.3.1.1 (A:) Cytochrome c2 {Rhodospirillum rubrum [TaxId: 1085]} egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk
Timeline for d3c2ca_: