SCOPe 2.08: Domain d1qn2b_: 1qn2 B:

Lineage for d1qn2b_ (1qn2 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome ch [46648] (1 species)

7. Species Methylobacterium extorquens [TaxId:408] [46649] (1 PDB entry)

8. Domain d1qn2b_: 1qn2 B: [15883]
   complexed with hec

Details for d1qn2b_

PDB Entry: 1qn2, 2.01 Å

PDB Description: cytochrome ch from methylobacterium extorquens

PDB Compounds: (B:) cytochrome ch

SCOPe Domain Sequences for d1qn2b_:

Sequence; same for both SEQRES and ATOM records:

>d1qn2b_ a.3.1.1 (B:) Cytochrome ch {Methylobacterium extorquens [TaxId: 408]}
gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad
lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk

Timeline for d1qn2b_:

• d1qn2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qn2b_ appears in SCOPe 2.07