Lineage for d1qn2a_ (1qn2 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1083Protein Cytochrome ch [46648] (1 species)
  7. 1084Species Methylobacterium extorquens [TaxId:408] [46649] (1 PDB entry)
  8. 1085Domain d1qn2a_: 1qn2 A: [15882]

Details for d1qn2a_

PDB Entry: 1qn2 (more details), 2.01 Å

PDB Description: cytochrome ch from methylobacterium extorquens
PDB Compounds: (A:)

SCOP Domain Sequences for d1qn2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qn2a_ a.3.1.1 (A:) Cytochrome ch {Methylobacterium extorquens}
egdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqa
dlkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk

SCOP Domain Coordinates for d1qn2a_:

Click to download the PDB-style file with coordinates for d1qn2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qn2a_: