SCOP 1.71: Domain d1cyc__: 1cyc -

Lineage for d1cyc__ (1cyc -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Bonito (Katsuwonus pelamis) [TaxId:8226] [46647] (1 PDB entry)

8. Domain d1cyc__: 1cyc - [15881]
   complexed with hem

Details for d1cyc__

PDB Entry: 1cyc, 2.3 Å

PDB Description: the crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 angstroms resolution. ii. structure and function

SCOP Domain Sequences for d1cyc__:

Sequence; same for both SEQRES and ATOM records:

>d1cyc__ a.3.1.1 (-) Mitochondrial cytochrome c {Bonito (Katsuwonus pelamis)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
entlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d1cyc__:

• d1cyc__ first appeared (with stable ids) in SCOP 1.55
  
• d1cyc__ appears in SCOP 1.69
  
• d1cyc__ is called d1cyca_ in SCOP 1.73
  
• d1cyc__ appears in the current release, SCOPe 2.08, called d1cyca_