Lineage for d3cyti_ (3cyt I:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277141Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 277142Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 277143Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 277289Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 277346Species Tuna (Thunnus alalunga and Thunnus thynnus) [46646] (5 PDB entries)
  8. 277354Domain d3cyti_: 3cyt I: [15880]
    complexed with hem

Details for d3cyti_

PDB Entry: 3cyt (more details), 1.8 Å

PDB Description: redox conformation changes in refined tuna cytochrome c

SCOP Domain Sequences for d3cyti_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cyti_ a.3.1.1 (I:) Mitochondrial cytochrome c {Tuna (Thunnus alalunga and Thunnus thynnus)}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

SCOP Domain Coordinates for d3cyti_:

Click to download the PDB-style file with coordinates for d3cyti_.
(The format of our PDB-style files is described here.)

Timeline for d3cyti_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cyto_