SCOPe 2.06: Domain d5cytr_: 5cyt R:

Lineage for d5cytr_ (5cyt R:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Bluefin tuna (Thunnus thynnus) [TaxId:8237] [46646] (5 PDB entries)
   identical sequence to Thunnus alalunga, TaxId: 8235

8. Domain d5cytr_: 5cyt R: [15878]
   complexed with hem

Details for d5cytr_

PDB Entry: 5cyt, 1.5 Å

PDB Description: refinement of myoglobin and cytochrome c

PDB Compounds: (R:) cytochrome c

SCOPe Domain Sequences for d5cytr_:

Sequence; same for both SEQRES and ATOM records:

>d5cytr_ a.3.1.1 (R:) Mitochondrial cytochrome c {Bluefin tuna (Thunnus thynnus) [TaxId: 8237]}
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats

Timeline for d5cytr_:

• d5cytr_ first appeared (with stable ids) in SCOP 1.55
  
• d5cytr_ appears in SCOPe 2.05
  
• d5cytr_ appears in SCOPe 2.07
  
• d5cytr_ appears in the current release, SCOPe 2.08