SCOPe 2.01: Domain d1ccra_: 1ccr A:

Lineage for d1ccra_ (1ccr A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Rice embryos (Oryza sativa) [TaxId:4530] [46645] (1 PDB entry)

8. Domain d1ccra_: 1ccr A: [15877]
   complexed with hem

Details for d1ccra_

PDB Entry: 1ccr, 1.5 Å

PDB Description: structure of rice ferricytochrome c at 2.0 angstroms resolution

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1ccra_:

Sequence; same for both SEQRES and ATOM records:

>d1ccra_ a.3.1.1 (A:) Mitochondrial cytochrome c {Rice embryos (Oryza sativa) [TaxId: 4530]}
asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad
knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats

Timeline for d1ccra_:

• d1ccra_ first appeared (with stable ids) in SCOP 1.55, called d1ccr__
  
• d1ccra_ appears in SCOP 1.75
  
• d1ccra_ appears in SCOPe 2.02
  
• d1ccra_ appears in the current release, SCOPe 2.08