Class a: All alpha proteins [46456] (171 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins) |
Protein Mitochondrial cytochrome c [46642] (5 species) |
Species Horse (Equus caballus) [TaxId:9796] [46644] (13 PDB entries) |
Domain d2pcbb_: 2pcb B: [15869] Other proteins in same PDB: d2pcba_, d2pcbc_ complexed with hem |
PDB Entry: 2pcb (more details), 2.8 Å
SCOP Domain Sequences for d2pcbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pcbb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Horse (Equus caballus)} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d2pcbb_: