SCOPe 2.04: Domain d1yica_: 1yic A:

Lineage for d1yica_ (1yic A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (52 PDB entries)
   Uniprot P00044

8. Domain d1yica_: 1yic A: [15863]
   complexed with hec

Details for d1yica_

PDB Entry: 1yic

PDB Description: the oxidized saccharomyces cerevisiae iso-1-cytochrome c, nmr, 20 structures

PDB Compounds: (A:) cytochrome c, iso-1

SCOPe Domain Sequences for d1yica_:

Sequence; same for both SEQRES and ATOM records:

>d1yica_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

Timeline for d1yica_:

• d1yica_ first appeared (with stable ids) in SCOP 1.55, called d1yic__
  
• d1yica_ appears in SCOPe 2.03
  
• d1yica_ appears in SCOPe 2.05
  
• d1yica_ appears in the current release, SCOPe 2.08