SCOPe 2.05: Domain d1fhba_: 1fhb A:

Lineage for d1fhba_ (1fhb A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
   Uniprot P00044

8. Domain d1fhba_: 1fhb A: [15862]
   complexed with cyn, hem

Details for d1fhba_

PDB Entry: 1fhb

PDB Description: three-dimensional solution structure of the cyanide adduct of a met80ala variant of saccharomyces cerevisiae iso-1-cytochrome c. identification of ligand-residue interactions in the distal heme cavity

PDB Compounds: (A:) ferricytochrome c

SCOPe Domain Sequences for d1fhba_:

Sequence; same for both SEQRES and ATOM records:

>d1fhba_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrqsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkaafgglkkekdrndlitylkkase

Timeline for d1fhba_:

• d1fhba_ first appeared (with stable ids) in SCOP 1.55, called d1fhb__
  
• d1fhba_ appears in SCOPe 2.04
  
• d1fhba_ appears in SCOPe 2.06
  
• d1fhba_ appears in the current release, SCOPe 2.08