Lineage for d1rapa_ (1rap A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1477026Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 1477027Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (52 PDB entries)
    Uniprot P00044
  8. 1477064Domain d1rapa_: 1rap A: [15858]
    complexed with hem, so4

Details for d1rapa_

PDB Entry: 1rap (more details), 2.25 Å

PDB Description: the structure and function of omega loop a replacements in cytochrome c
PDB Compounds: (A:) rep a2 iso-1-cytochrome c

SCOPe Domain Sequences for d1rapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rapa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtfdqggankvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

SCOPe Domain Coordinates for d1rapa_:

Click to download the PDB-style file with coordinates for d1rapa_.
(The format of our PDB-style files is described here.)

Timeline for d1rapa_: