SCOP 1.63: Domain d1irw__: 1irw -

Lineage for d1irw__ (1irw -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (32 PDB entries)

8. Domain d1irw__: 1irw - [15855]
   complexed with hem, m3l, so4; mutant

Details for d1irw__

PDB Entry: 1irw, 2 Å

PDB Description: cytochrome c isozyme 1, reduced, mutant with asn 52 replaced by ala and cys 102 replaced by thr

SCOP Domain Sequences for d1irw__:

Sequence; same for both SEQRES and ATOM records:

>d1irw__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaaikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d1irw__:

• d1irw__ first appeared (with stable ids) in SCOP 1.55
  
• d1irw__ appears in SCOP 1.61
  
• d1irw__ appears in SCOP 1.65
  
• d1irw__ appears in the current release, SCOPe 2.08, called d1irwa_