SCOP 1.75: Domain d1ctza_: 1ctz A:

Lineage for d1ctza_ (1ctz A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (43 PDB entries)
   Uniprot P00044

8. Domain d1ctza_: 1ctz A: [15853]
   complexed with hem, so4, tml; mutant

Details for d1ctza_

PDB Entry: 1ctz, 1.9 Å

PDB Description: mutation of tyrosine-67 in cytochrome c significantly alters the local heme environment

PDB Compounds: (A:) cytochrome c

SCOP Domain Sequences for d1ctza_:

Sequence; same for both SEQRES and ATOM records:

>d1ctza_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d1ctza_:

• d1ctza_ first appeared (with stable ids) in SCOP 1.55, called d1ctz__
  
• d1ctza_ appears in SCOP 1.73
  
• d1ctza_ appears in SCOPe 2.01
  
• d1ctza_ appears in the current release, SCOPe 2.08