Lineage for d1ctz__ (1ctz -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 210025Protein Mitochondrial cytochrome c [46642] (5 species)
  7. 210026Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (32 PDB entries)
  8. 210047Domain d1ctz__: 1ctz - [15853]
    complexed with hem, so4, tml; mutant

Details for d1ctz__

PDB Entry: 1ctz (more details), 1.9 Å

PDB Description: mutation of tyrosine-67 in cytochrome c significantly alters the local heme environment

SCOP Domain Sequences for d1ctz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctz__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOP Domain Coordinates for d1ctz__:

Click to download the PDB-style file with coordinates for d1ctz__.
(The format of our PDB-style files is described here.)

Timeline for d1ctz__: