SCOPe 2.01: Domain d1csva_: 1csv A:

Lineage for d1csva_ (1csv A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (45 PDB entries)
   Uniprot P00044

8. Domain d1csva_: 1csv A: [15850]
   complexed with hem, so4

Details for d1csva_

PDB Entry: 1csv, 1.9 Å

PDB Description: replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1csva_:

Sequence; same for both SEQRES and ATOM records:

>d1csva_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafggfkkekdrndlitylkkate

Timeline for d1csva_:

• d1csva_ first appeared (with stable ids) in SCOP 1.55, called d1csv__
  
• d1csva_ appears in SCOP 1.75
  
• d1csva_ appears in SCOPe 2.02
  
• d1csva_ appears in the current release, SCOPe 2.08