SCOPe 2.05: Domain d1crha_: 1crh A:

Lineage for d1crha_ (1crh A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
   Uniprot P00044

8. Domain d1crha_: 1crh A: [15849]
   complexed with hem, so4

Details for d1crha_

PDB Entry: 1crh, 1.9 Å

PDB Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1crha_:

Sequence; same for both SEQRES and ATOM records:

>d1crha_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

Timeline for d1crha_:

• d1crha_ first appeared (with stable ids) in SCOP 1.55, called d1crh__
  
• d1crha_ appears in SCOPe 2.04
  
• d1crha_ appears in SCOPe 2.06
  
• d1crha_ appears in the current release, SCOPe 2.08