Lineage for d1crha_ (1crh A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760825Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 760826Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (43 PDB entries)
    Uniprot P00044
  8. 760848Domain d1crha_: 1crh A: [15849]
    complexed with hem, so4, tml; mutant

Details for d1crha_

PDB Entry: 1crh (more details), 1.9 Å

PDB Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
PDB Compounds: (A:) cytochrome c

SCOP Domain Sequences for d1crha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crha_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

SCOP Domain Coordinates for d1crha_:

Click to download the PDB-style file with coordinates for d1crha_.
(The format of our PDB-style files is described here.)

Timeline for d1crha_: