Class a: All alpha proteins [46456] (179 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins) |
Protein Mitochondrial cytochrome c [46642] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (33 PDB entries) |
Domain d1crh__: 1crh - [15849] complexed with hem, so4, tml; mutant |
PDB Entry: 1crh (more details), 1.9 Å
SCOP Domain Sequences for d1crh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1crh__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)} tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace
Timeline for d1crh__: