Lineage for d1chia_ (1chi A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 904883Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 904884Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (45 PDB entries)
    Uniprot P00044
  8. 904904Domain d1chia_: 1chi A: [15848]
    complexed with hem, so4

Details for d1chia_

PDB Entry: 1chi (more details), 2 Å

PDB Description: structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1chia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chia_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmayggakkekdrndlitylkkate

SCOPe Domain Coordinates for d1chia_:

Click to download the PDB-style file with coordinates for d1chia_.
(The format of our PDB-style files is described here.)

Timeline for d1chia_: