SCOP 1.65: Domain d1chi__: 1chi -

Lineage for d1chi__ (1chi -)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (33 PDB entries)

8. Domain d1chi__: 1chi - [15848]
   complexed with hem, so4, tml; mutant

Details for d1chi__

PDB Entry: 1chi, 2 Å

PDB Description: structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c

SCOP Domain Sequences for d1chi__:

Sequence; same for both SEQRES and ATOM records:

>d1chi__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmayggakkekdrndlitylkkate

Timeline for d1chi__:

• d1chi__ first appeared (with stable ids) in SCOP 1.55
  
• d1chi__ appears in SCOP 1.63
  
• d1chi__ appears in SCOP 1.67
  
• d1chi__ appears in the current release, SCOPe 2.08, called d1chia_