SCOP 1.71: Domain d1crj__: 1crj -

Lineage for d1crj__ (1crj -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (35 PDB entries)

8. Domain d1crj__: 1crj - [15842]
   complexed with hem, so4, tml; mutant

Details for d1crj__

PDB Entry: 1crj, 2.05 Å

PDB Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c

SCOP Domain Sequences for d1crj__:

Sequence; same for both SEQRES and ATOM records:

>d1crj__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate

Timeline for d1crj__:

• d1crj__ first appeared (with stable ids) in SCOP 1.55
  
• d1crj__ appears in SCOP 1.69
  
• d1crj__ is called d1crja_ in SCOP 1.73
  
• d1crj__ appears in the current release, SCOPe 2.08, called d1crja_