SCOP 1.63: Domain d1csu__: 1csu -

Lineage for d1csu__ (1csu -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Mitochondrial cytochrome c [46642] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (32 PDB entries)

8. Domain d1csu__: 1csu - [15837]
   complexed with hem, so4, tml; mutant

Details for d1csu__

PDB Entry: 1csu, 1.81 Å

PDB Description: replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c

SCOP Domain Sequences for d1csu__:

Sequence; same for both SEQRES and ATOM records:

>d1csu__ a.3.1.1 (-) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae)}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafggckkekdrndlitylkkate

Timeline for d1csu__:

• d1csu__ first appeared (with stable ids) in SCOP 1.55
  
• d1csu__ appears in SCOP 1.61
  
• d1csu__ appears in SCOP 1.65
  
• d1csu__ appears in the current release, SCOPe 2.08, called d1csua_