SCOP 1.71: Domain d1c7ma_: 1c7m A:

Lineage for d1c7ma_ (1c7m A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c552 [46636] (5 species)

7. Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries)

8. Domain d1c7ma_: 1c7m A: [15830]
   complexed with hec

Details for d1c7ma_

PDB Entry: 1c7m

PDB Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state

SCOP Domain Sequences for d1c7ma_:

Sequence; same for both SEQRES and ATOM records:

>d1c7ma_ a.3.1.1 (A:) Cytochrome c552 {Paracoccus denitrificans}
madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
alqefltnpkavvkgtkmafaglpkiedranliaylegqq

Timeline for d1c7ma_:

• d1c7ma_ first appeared (with stable ids) in SCOP 1.55
  
• d1c7ma_ appears in SCOP 1.69
  
• d1c7ma_ appears in SCOP 1.73
  
• d1c7ma_ appears in the current release, SCOPe 2.08