Lineage for d1cnoh_ (1cno H:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 633914Protein Cytochrome c552 [46636] (5 species)
  7. 633937Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry)
  8. 633945Domain d1cnoh_: 1cno H: [15821]
    complexed with gol, hec

Details for d1cnoh_

PDB Entry: 1cno (more details), 2.2 Å

PDB Description: structure of pseudomonas nautica cytochrome c552, by mad method
PDB Compounds: (H:) cytochrome c552

SCOP Domain Sequences for d1cnoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnoh_ a.3.1.1 (H:) Cytochrome c552 {Pseudomonas nautica [TaxId: 2743]}
agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
qgqatalsdadianlaayyasnpaaa

SCOP Domain Coordinates for d1cnoh_:

Click to download the PDB-style file with coordinates for d1cnoh_.
(The format of our PDB-style files is described here.)

Timeline for d1cnoh_: