SCOPe 2.02: Domain d3elia1: 3eli A:2-144

Lineage for d3elia1 (3eli A:2-144)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (11 proteins)
   Pfam PF05146

6. Protein Uncharacterized protein SPO3351 [160734] (1 species)

7. Species Silicibacter pomeroyi [TaxId:89184] [160735] (1 PDB entry)
   Uniprot Q5LN61 2-144

8. Domain d3elia1: 3eli A:2-144 [158184]

Details for d3elia1

PDB Entry: 3eli, 2.8 Å

PDB Description: Crystal structure of the AHSA1 (SPO3351) protein from Silicibacter pomeroyi, Northeast Structural Genomics Consortium Target SiR160

PDB Compounds: (A:) Aha1 domain protein

SCOPe Domain Sequences for d3elia1:

Sequence, based on SEQRES records:

>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]}
adlrlerefavapealfawvsdgakllqwwgpeglhvpadqhdldftrlgpwfsvmvnge
gqrykvsgqvthvkppqsvgftwgwhddddrrgaeshvmfivepcakgarlildhrelgd
demslrheegwtsslrklaaela

Sequence, based on observed residues (ATOM records):

>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]}
adlrlerefavapealfawvsdgakllqwwgpeglhvpadqhdldftrlgpwfsvmvnge
gqrykvsgqvthvkppqsvgftwgwhddddrrgaeshvmfivepcgarlildhrelgdde
mslrheegwtsslrklaaela

Timeline for d3elia1:

• d3elia1 first appeared in SCOP 1.75
  
• d3elia1 appears in SCOPe 2.01
  
• d3elia1 appears in SCOPe 2.03
  
• d3elia1 appears in the current release, SCOPe 2.08