Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
Domain d3eidd1: 3eid D:178-309 [158162] Other proteins in same PDB: d3eida_, d3eidc_ automated match to d1finb1 complexed with po5 |
PDB Entry: 3eid (more details), 3.15 Å
SCOPe Domain Sequences for d3eidd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eidd1 a.74.1.1 (D:178-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl vlkvltfdlaap
Timeline for d3eidd1:
View in 3D Domains from other chains: (mouse over for more information) d3eida_, d3eidb1, d3eidb2, d3eidc_ |