SCOPe 2.06: Domain d3ehwc_: 3ehw C:

Lineage for d3ehwc_ (3ehw C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226031] (5 PDB entries)

8. Domain d3ehwc_: 3ehw C: [158156]
   automated match to d4apza_
   complexed with dup, mg

Details for d3ehwc_

PDB Entry: 3ehw, 1.8 Å

PDB Description: Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the full-length C-termini in all monomers and suggestion for an additional metal ion binding site

PDB Compounds: (C:) dUTP pyrophosphatase

SCOPe Domain Sequences for d3ehwc_:

Sequence; same for both SEQRES and ATOM records:

>d3ehwc_ b.85.4.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrvap
rsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeiee
vqalddtergsggfgstgkn

Timeline for d3ehwc_:

• d3ehwc_ first appeared in SCOP 1.75, called d3ehwc1
  
• d3ehwc_ appears in SCOPe 2.05
  
• d3ehwc_ appears in SCOPe 2.07
  
• d3ehwc_ appears in the current release, SCOPe 2.08