Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
Domain d3ehbc_: 3ehb C: [158152] Other proteins in same PDB: d3ehba_, d3ehbb1, d3ehbb2 automated match to d1mqkh_ complexed with ca, cu, hea, lda, lmt, mg, per; mutant |
PDB Entry: 3ehb (more details), 2.32 Å
SCOPe Domain Sequences for d3ehbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ehbc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssa
Timeline for d3ehbc_:
View in 3D Domains from other chains: (mouse over for more information) d3ehba_, d3ehbb1, d3ehbb2, d3ehbd_ |