SCOPe 2.04: Domain d3ehbc_: 3ehb C:

Lineage for d3ehbc_ (3ehb C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)

8. Domain d3ehbc_: 3ehb C: [158152]
   Other proteins in same PDB: d3ehba_, d3ehbb1, d3ehbb2
   automated match to d1mqkh_
   complexed with ca, cu, hea, lda, lmt, mg, per; mutant

Details for d3ehbc_

PDB Entry: 3ehb, 2.32 Å

PDB Description: a d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate

PDB Compounds: (C:) FV fragment Chain H

SCOPe Domain Sequences for d3ehbc_:

Sequence; same for both SEQRES and ATOM records:

>d3ehbc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssa

Timeline for d3ehbc_:

• d3ehbc_ first appeared in SCOP 1.75, called d3ehbc1
  
• d3ehbc_ appears in SCOPe 2.03
  
• d3ehbc_ appears in SCOPe 2.05
  
• d3ehbc_ appears in the current release, SCOPe 2.07