Lineage for d1cnob_ (1cno B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209946Protein Cytochrome c552 [46636] (5 species)
  7. 209964Species Pseudomonas nautica [TaxId:2743] [46638] (1 PDB entry)
  8. 209966Domain d1cnob_: 1cno B: [15815]

Details for d1cnob_

PDB Entry: 1cno (more details), 2.2 Å

PDB Description: structure of pseudomonas nautica cytochrome c552, by mad method

SCOP Domain Sequences for d1cnob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnob_ a.3.1.1 (B:) Cytochrome c552 {Pseudomonas nautica}
agdieagkakaavcaachgqngisqvpiypnlagqkeqylvaalkaykagqrqggqapvm
qgqatalsdadianlaayyasnpaaa

SCOP Domain Coordinates for d1cnob_:

Click to download the PDB-style file with coordinates for d1cnob_.
(The format of our PDB-style files is described here.)

Timeline for d1cnob_: