Lineage for d3efxl_ (3efx L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2059042Species Vibrio cholerae [TaxId:37965] [187230] (2 PDB entries)
  8. 2059056Domain d3efxl_: 3efx L: [158142]
    Other proteins in same PDB: d3efxd1
    automated match to d1eeid_

Details for d3efxl_

PDB Entry: 3efx (more details), 1.94 Å

PDB Description: novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
PDB Compounds: (L:) Cholera enterotoxin subunit B, Heat-labile enterotoxin B chain

SCOPe Domain Sequences for d3efxl_:

Sequence, based on SEQRES records: (download)

>d3efxl_ b.40.2.1 (L:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

Sequence, based on observed residues (ATOM records): (download)

>d3efxl_ b.40.2.1 (L:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpdsqkkai
ermkdtlriaylteakveklcvwnnktpnsiaaisma

SCOPe Domain Coordinates for d3efxl_:

Click to download the PDB-style file with coordinates for d3efxl_.
(The format of our PDB-style files is described here.)

Timeline for d3efxl_: