SCOP 1.63: Domain d1dt1a_: 1dt1 A:

Lineage for d1dt1a_ (1dt1 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Cytochrome c552 [46636] (5 species)

7. Species Thermus thermophilus [TaxId:274] [46637] (3 PDB entries)

8. Domain d1dt1a_: 1dt1 A: [15811]

Details for d1dt1a_

PDB Entry: 1dt1, 1.8 Å

PDB Description: thermus thermophilus cytochrome c552 synthesized by escherichia coli

SCOP Domain Sequences for d1dt1a_:

Sequence; same for both SEQRES and ATOM records:

>d1dt1a_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk

Timeline for d1dt1a_:

• d1dt1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dt1a_ appears in SCOP 1.61
  
• d1dt1a_ appears in SCOP 1.65
  
• d1dt1a_ appears in the current release, SCOPe 2.08