SCOP 1.73: Domain d1c52a_: 1c52 A:

Lineage for d1c52a_ (1c52 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c552 [46636] (5 species)

7. Species Thermus thermophilus [TaxId:274] [46637] (6 PDB entries)

8. Domain d1c52a_: 1c52 A: [15810]
   complexed with hem

Details for d1c52a_

PDB Entry: 1c52, 1.28 Å

PDB Description: thermus thermophilus cytochrome-c552: a new highly thermostable cytochrome-c structure obtained by mad phasing

PDB Compounds: (A:) cytochrome-c552

SCOP Domain Sequences for d1c52a_:

Sequence; same for both SEQRES and ATOM records:

>d1c52a_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
qadgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqiev
kgmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqq
vlaerkklglk

Timeline for d1c52a_:

• d1c52a_ first appeared (with stable ids) in SCOP 1.55, called d1c52__
  
• d1c52a_ was called d1c52__ in SCOP 1.71
  
• d1c52a_ appears in SCOP 1.75
  
• d1c52a_ appears in the current release, SCOPe 2.08