SCOPe 2.04: Domain d3eb6b1: 3eb6 B:1-147

Lineage for d3eb6b1 (3eb6 B:1-147)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [160080] (1 PDB entry)

8. Domain d3eb6b1: 3eb6 B:1-147 [158081]
   automatically matched to d1ur6a_
   complexed with zn

Details for d3eb6b1

PDB Entry: 3eb6, 3.4 Å

PDB Description: Structure of the cIAP2 RING domain bound to UbcH5b

PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d3eb6b1:

Sequence; same for both SEQRES and ATOM records:

>d3eb6b1 d.20.1.1 (B:1-147) Ubiquitin conjugating enzyme, UBC {African clawed frog (Xenopus laevis) [TaxId: 8355]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d3eb6b1:

• d3eb6b1 first appeared in SCOP 1.75
  
• d3eb6b1 appears in SCOPe 2.03
  
• d3eb6b1 appears in SCOPe 2.05
  
• d3eb6b1 appears in the current release, SCOPe 2.08