Lineage for d3ea5d1 (3ea5 D:1-861)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775278Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
  6. 775320Protein Importin beta [48378] (3 species)
  7. 775321Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140814] (3 PDB entries)
    Uniprot Q06142 1-861
  8. 775324Domain d3ea5d1: 3ea5 D:1-861 [158075]
    automatically matched to d2bkub1
    complexed with gdp, mg; mutant

Details for d3ea5d1

PDB Entry: 3ea5 (more details), 2.5 Å

PDB Description: Kap95p Binding Induces the Switch Loops of RanGDP to adopt the GTP-bound Conformation: Implications for Nuclear Import Complex Assembly Dynamics
PDB Compounds: (D:) Importin subunit beta-1

SCOP Domain Sequences for d3ea5d1:

Sequence, based on SEQRES records: (download)

>d3ea5d1 a.118.1.1 (D:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
sqatkdtarwareqqkrqlsl

Sequence, based on observed residues (ATOM records): (download)

>d3ea5d1 a.118.1.1 (D:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesaniliaivqgaqste
tskavrlaalnaladslifiknnmeregernylmqvvceatqaedievqaaafgclckim
skyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidiayelaqfpqspl
qsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaqncgnhilepvle
fveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmndqslqvketta
wcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlveqlaeatpspi
ynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsasistfvmdklgq
tmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmglffrllekkdsa
fieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgfiadisnslee
dfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipylndimalcvaaq
ntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqfiaqvaedpql
ysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsqatkdtarwar
eqqkrqlsl

SCOP Domain Coordinates for d3ea5d1:

Click to download the PDB-style file with coordinates for d3ea5d1.
(The format of our PDB-style files is described here.)

Timeline for d3ea5d1: