SCOPe 2.07: Domain d3e9oa1: 3e9o A:1836-2087

Lineage for d3e9oa1 (3e9o A:1836-2087)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
   automatically mapped to Pfam PF12134

6. Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
   Uniprot P33334 1833-2087! Uniprot P33334 1835-2087

8. Domain d3e9oa1: 3e9o A:1836-2087 [158069]
   Other proteins in same PDB: d3e9oa2

Details for d3e9oa1

PDB Entry: 3e9o, 2 Å

PDB Description: Crystal Structure of Yeast Prp8, Residues 1836-2092

PDB Compounds: (A:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d3e9oa1:

Sequence; same for both SEQRES and ATOM records:

>d3e9oa1 c.55.3.14 (A:1836-2087) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih
tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia
irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral
ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisalt
qteikdiilgqn

Timeline for d3e9oa1:

• d3e9oa1 first appeared in SCOP 1.75
  
• d3e9oa1 appears in SCOPe 2.06